Found 60 companies
No.188 Shuanghubei Rd., Hongqi Industrial Dst. Jinwan Dst.
Located in the beautiful coastal city of Zhuhai, next to Macau and Hong Kong, specializing in plastic,metal & electronic products development and manufacturing, Mingbo Technology is a hi-tech ...
WENHUA ROAD, HANCHUAN, HUBEI, China
We are the manufacturer and exporter in baby products. With over six years effort, We have gained great experience in handing customers sourcing need. We can supply you large products selection. That ...
chuanye street Wuhan, Hubei
dfasdfasdfsdfasdfasdaffsdfasdfasdfasdfasdfasdfasdfasdfasdfasdfasdfsadfsadfasdfasdfasdfasdfasdfasdfasdfsadfasdfasdfasdfasdfasdfwerterymhkuisrwef...
Wuhan Shimeixianke International Trade and Investment co., ltd.(Shimei International for short) is a member company of Star Group which is located in Wuhan Jianghan economic development district(namel...
NO.01 Gonglu street XingYan Hanchuan Hubei ***, NO.01 Gonglu street XingYan
For transport equipment to be on point it takes, durable make, highest quality raw material and design that caters to smooth functionality. Qingfeng inflatables Co., Ltd. excel in Inflatable Game indu...
Fine Test Biological Technology Co.,Ltd is a high tech company located in Wuhan, C6-328 Biolake,No.666 Gaoxin AVE,China, mainly focused on R&D, manufacture and marketing of Antibodies, Protein...
Guantangnao Village Chengui Town Daye City, Huangshi, Hubei, China
Daye Wanshun Children&＃039;s Appliances Co., LTD, founded in2005, is a professional manufacturer of baby walkers and strollers in China. Our main products include baby walkers, strollers and t...
Room 503, Jia Zuo Section 3, Jiaxing Yuan, Fazhan Ave., Jianghan Dist. Wuhan, Hubei
Operating since 2001Founded in 2001, Wuhan Willita (Toys) Industrial Co. Ltd is a specialized supplier of the plush toys, soft toys, stuffed animals and plush keychains in China. Our products are expo...
guanggu,wuhan,hubei Xiangfan, Hubei
Features: 1) Dimensions: 7.1*5.2*3.5m 2) Component: Tube slides, observatory, panels, ladders 3) Player age: 3 - 12 4) Capacity: 25 people 5) Material: LLDPE, aluminum, galvanized steel...
Qiaokouqu Gonlonlu 8
We are the experienced manufactory located in Wuhan-where is almost the biggest city in the Central of China and primary engage in high-end handicrafts, carvings, particular on the ship modeling. &a...
xiongzui Xiaogan Hubei ***, xiongzui
For automotive construction and maintenance the demand for highest quality automotive parts is no longer behind the supply and we take pride to be listed among to RC Motors Exporters and Suppliers. Ae...
Room 102,E1 Building,Optical Valley Software Park,Wuhan,China Wuhan, Hubei
We mainly provide oversea buyers Inspection service as: Factory Audit ,Factory Investigation, Products quality Inspection, Cargo Loading Supervision,supplier introduce and Free consultation....
316 National Highway Side Liutai Village,Tang Town,Suixian County Suizhou City,Hubei Province
Our company is a manufacturing enterprise specialized in producing latex toys. Since our inception, all the products have been exported to customers all over the world. All of our raw materials are pu...
Wuhan Hi-tech Medical Devices Park, Building B11,#818 Gaoxin Road, Donghu Hi-Tech Development Area, Wuhan, Hubei
Our main business includes recombinant proteins and antibodies (CusAb), ELISA kits (CUSABIO), raw materials for diagnostic reagents (CUSAg), food safety testing products (WHISERKON). We mainly provide...
guanggu changyejie Wuhan, Hubei
Features:1) Product dimensions: 5 x 4 x 5cm2) Wind up powered3) Latest design4) Lively emotion expression5) Series of emotions will be followedInner packing:12pcs/dozen boxOuter packing:1920pcs/ctn Ca...
Around Rive Road Wufeng Hubei ***, Around Rive Road
In the most revolutionizing industry Vivid Wooden Toy Manufacturing Co., Ltd Private Limited has reached a milestone owing to the top notch production facility with technologically advanced equipment ...
NO.43 sanjiao road wuchang district Wuhan, Hubei
The electron my company in manufacturing electronic puzzle, by splitting joint simplely , being able to get several thousands kind the common middle electron product living such as radio set , recorde...
Related Categories